PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.2NG218100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family TALE
Protein Properties Length: 752aa    MW: 78271.8 Da    PI: 7.1433
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.2NG218100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.52.7e-095555921954
                          HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
             Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                          Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  Pavir.2NG218100.1.p 555 FEHflHPYPSDADKHLLARQTGLSRNQVSNWFINARVR 592
                          564459******************************88 PP

2BELL120.48.2e-39416486272
                 BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                          r e+q+kkakL+s+l+eVd+rY++y++q+q+v++ F+ v+g g+a+pYt+lA+ka+SrhFrcLkdaia+q+
  Pavir.2NG218100.1.p 416 RFEHQRKKAKLISMLDEVDRRYNHYCDQMQMVVNFFDSVMGFGAATPYTALAQKAMSRHFRCLKDAIASQL 486
                          779******************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005744.0E-70338484IPR006563POX domain
PfamPF075261.6E-52343483IPR006563POX domain
PROSITE profilePS5007112.6533596IPR001356Homeobox domain
CDDcd000864.24E-13536597No hitNo description
SMARTSM003891.6E-9536600IPR001356Homeobox domain
SuperFamilySSF466892.57E-17538603IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-28539602IPR009057Homeodomain-like
PfamPF059203.8E-18553592IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 752 aa     Download sequence    Send to blast
MGIAAPPSQP GQTTTYVRSQ PNKSSAAISG RPATASSMSH SQGFHQGSSG VFGYSSDGFD  60
RPDSSQDYPQ QHVAQQSRRD KLRVQGFDPA AAAAAGRGLL PIEGDEHAEP GAMYEHAAAA  120
GASNMLSEMF NFPAPPSGPS ATELLASQMN ANYRFGLRQG PGGVAGLSGD GGWFGAAGAA  180
GRAGLVLSGA SMGSLGETSS PKQQGSMAGL ATDPASAMQL FLMNPQQQQQ SRSSPTSPQQ  240
PSDVQQHHEA FQAFGGGAAA AFGGGGAGGV VEGQGLSLSL SPSLQQLEMA KQAEELRVRD  300
GVLYFNRQQQ QQQQVPMALH GGQVGALGQQ LHVGYGPAGV AGVLRNSKYT RAAQELLEEF  360
CSVGRGQIKG GGGRGASASN PSAGKGGGGG GASSSGAAQS PSSASKEPPQ LSPADRFEHQ  420
RKKAKLISML DEVDRRYNHY CDQMQMVVNF FDSVMGFGAA TPYTALAQKA MSRHFRCLKD  480
AIASQLRHTC EVLGEKDAGT SSGLTKGETP RLRAIDQSLR QQRAFHHMGM MEQEAWRPQR  540
GLPERSVNIL RSWLFEHFLH PYPSDADKHL LARQTGLSRN QVSNWFINAR VRLWKPMIEE  600
MYQQECRELE GSSAGGGAPE SGNDPSGADD THSPTTTGAV AQQLPQQHGT AAPGMMMPHK  660
PDPGAAGPSA ADAAFVGIDP VELLGGDAHV GGGGADLYGR FEPGVRVRYG PGATAAAAGD  720
VSLTLGLQHA GAGNAGPDGT GRFSLRDYSG C*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A1e-17542599158Homeobox protein Meis1
4xrs_B1e-17542599158Homeobox protein Meis1
5bng_A1e-17542600159Homeobox protein Meis2
5bng_B1e-17542600159Homeobox protein Meis2
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.170810.0leaf| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9575010.0EU957501.1 Zea mays clone 1595427 homeodomain protein JUBEL1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004981881.10.0PREDICTED: BEL1-like homeodomain protein 4
SwissprotQ94KL51e-142BLH4_ARATH; BEL1-like homeodomain protein 4
TrEMBLF2CYW10.0F2CYW1_HORVD; Predicted protein
STRINGMLOC_58467.30.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44332945
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23760.31e-126BEL1-like homeodomain 4